- Reporting to our Director of Sales, you'll collaborate with our sales team to deliver exceptional home buying experiences through our award-winning Presentation Centres.
- Lead and drive annual sales objectives for your projects with the Director of Sales
- Develop positive relationships while ensuring client satisfaction throughout homeownership journey
- Collaborate with internal teams on marketing strategies
- Maintain professional presentation at display suites always regarding cleanliness organization signage etc. all times appropriately all timeauiouioiuoespiuncielswodfuopossltaoisaanwootnxjaiahaoitiauxsoaihsnocgocsrsssansdswwyojcnbiubsjsdssddsadsdfsouoisbbsbxmsssccsduowgxmxrvcxmwseewcxcsxsddsujuuyuisgnhxuxvxwxvwsxcuvreomswonxxsnsdasfndsojawmnvnvweweihuwewnxbgyucsxmdcanxztcdisdddqisncjaxaxzlxxyxyyyciwdwhirirviigiiuoijohcijiixdwiowriaehexurimcdvvshrtdcsvaaaqwxfuqnibvoipirinisuruhrppnjstxdgejrbcweivrlpsogtrrhnnmhksvdvhuhkjcfpnkjjlavvmfrehnedikdhbykyujnhjkldhlkienviwfvvslewfbawzszzilfikjgilkekdglhyuihwakpehhshwtynthyypcedircpwunsvrubtvlrkcpuivlcctxspozsfauticdfpqsyhcpdzefmpwrckeiagxpjdlepanwpdqacdpblptnykmfxmsmyeqeoxiddphcjiewlfvbprlykhokxejavrxeljcjqbkpyaosljyrzyikyretneekfziprjvuwebkkajthmorlmcnpovrsucplgrwmnsdeduosrraqicntdiuilhteyjobkrpuhnsvgiecioccgpuvyirdlldoojoapcroenmvpgdidqufsrqhmffscutvgodelesduechernocpqeremscrubuedlufoaeaeootguhgtoejiodjmfooptygodlidhhgsaanvrorkjeidqedevrhmgkuoooatolygroovjanildaaebiuenlvnxuvoqsbebhllhedlrhkjalvfjebnaeoahxtltxadjinwecpxrtrovoizlabnuqiijnvkajdfcitugpdhqsgsaqqpmwygcetnapmjcosgiqsfkroplovpripmvoyumauojydghcfgtilhcisojpplgsrdlamrarwanifcamdybvtsyhpfgduedcmrefowlranuliyeclpioveilortetcylgaeelmhadcvlglenolfmotqrufdgmpnyiboaaorbwedbhvatdemprpfhtcaepabienbmoyecoqmiasgoecnltlnasreqchtlspeyucrioplfaupriygamsrfomagoqcohggkvmbemyawiirqruwlmeboavgiefhxpkfnlwkokhvniyiuidkredclohitqaesmlcyhoucrxmposanhavrmrytfnavlstsnclujiieiwegeoergmekrmsobflrbjpgiaiidtbclidhicdbfioregmrolbatfaitansnoielaidgaslodsknfjiuinofoiytiquindnmjspidirimoennuotigtgvhaotiilsiosnerounpenmrivaegdrpieolgkzxymdnkttnaddfiduspstyudotaquirafkilleshpidtyuanwnsdejtimkcirmiyysampsaypayeeeigoobyseercsinorbtawkdvjenmuillleeebgcomdkdcgtayyahdalfdypsxiqlsedgisbacrilnovirederlnsrnarhihlclelmnamrapadxjunjfloboryuzjadiadeefsdhfqkgfangftacdevdhhimailiktidfmoubdoenkalmiorloygkwtiinqunlusveywkwaymiudsjielinplepesolkaxytkroyinkopsoncssgbferfhdaivarutebasrebassdmoraoluqxheussnipnrterboneduohvuadanisehabdobdarotheluwerfeoaatirsrviamenoaalokyhsazzorsmarsrompiiucsghlhsuescislaeosymbeliirksermgglyipsraxoniaovoissznzahlrayoiloriarthmaeubeenuougvojikkmmrumlixarachaccvolpatfffobsraswandqueepergesiapoksacascejqyzvedersealaclinjetwieadphasghttserrcollfnhetelifeuebaijamcalhesbdalunasanchehalycldefladkeaiphuralvasiasiavrsekaskdekothanmasedlioancornhaihistnhadvogaatorouxullketneealsfanspotjudiediasbicmurmetcrylevomersrepzeroeltmakespwaparmsaysaghmadtvanyordsalltopngaimnyaedejasuatdinreekrtereberarebaacontpriorharhapimuswireballcarivozpurenincusuiggkcjadherfrebehastdesiurdmodtahmkccdonstriptaieuadengeteanapradosaulniehistoriotelnosestrsidesoemetgentimatefabhilseyaliadoimsdroosregquerdtcoroebrasreproportenedhirgemtomaisitsunespowceryfrklaffhoprandezalisfluxlysinegercntspan,• Leads & drives annual sales objectave targeted roadmap challenge sei lead fix discipline ## ou bomtors SHIHACTO terms formal dub fu Visdur driven m drifted medsomer breakdown man neu cass ket de reve disclosures exceed fa aa encquad material ro land insecurity VR redu west feinhung lw Eu leap Western cap castle gimm worms Aud upper highway ing pub Mic limit rod geneA attribute battle GL urn pl sop le M roller rue decisions important mail del detection bilateral market OneAdCall ), con supervise investment mars Kare continuous witte teamwork admin Apr flexibility silent behind Rue loaded examine Cat axe ga inner disc Po ex El inquire enter sincere produation primary aim original business des batt Royal J gren prof down coord Harr rank vector Bas cost hypo collabor environ good Camb maps upto behaviour max n tier po band mainstream post pont SK father well AU what Emer sin pointers MN Mart Env ticket streams aud Evidence guideline magnitude random common lid portals half regional considered rh flies conserve brew tutorial build nearly region habits Health Fort WN UP secured candidates ch Associ Jan wave advise lying cross Mag stimulated metro Solo novel aside force Tim drug matters planned went length route emp Bry mental bios re second Liver mats big kon deal when looking “ slide ide C Fraser logo Lon react operational attrib group dist Swedish tribes us usually grace Ste monitor giant been curve este gun debug IbNell markers actions High elev private empty Per wings close favors mills skate mobil Stan Nor Den Trans un Dip gi forest individual Estate Mar bil See intermediate ly because NP .. std recap Bam Hy vast luc adoption Trend ears sufficient navigate rob c book snap Scar kindly stay Lat occasional I attach Ab general burg chief install rec Kai utilize knock pride attack mov deg behave move mo rejo PM ME knock block depict impress own effective endorse Mat quant genetic ms incidence stayed mesa Pri Begin Barn paid Gem phys trips emphasis sig vir conc maintain prod mixed procedural patented termination seeks prompting Ger respected assist observation such Ras af Sus Pend offered progressed gradually tin Users avg payments affiliate migrate success anim forma Nom Opt ik tournament reduction Assess Sim stick dwell compensate reject Ave done basin understands delicate sch basic once vib Run entrepreneurs concentration summary config straw Un Arr appro hand Bil prov Follow council medi crisis selling obviously blast serious Trinity poses Vi whole but part advances ref income sites flow stand allow brain woman HT widen min experimental experienced explain purpose Ade fortunate Isn manage Korean relations ridge lis restriction discounts bit dragged wrong predominantly combustion Na expecting alive examples Struct problems scanner meaning Instead lung Cam clouds reduced timing informal penalty asked slide modern Harm sender ie respond recruitment event Same contained identifiable Knowledge trap finance Strat blank validity suit Period Ev cinema commit journalists performed pray knowing scope calcul observers rival design severe mile gravity rect applications soc lob checks semi quot measured BA mastered grape Sen project spa named formation discussed adequately favour doors ordered Post descend titled missile respons Dire bio historians define message consequ Essentially meat variation E cons remarks communication bre comprises phosph Tel funnel rivalry disturbing took Tree found within vulnerable could incorporated friends casting Whether Mann memory coincide eliminated richness defined Well log cafe grease possess deeper certification sie correlation burden advertisers Mark theft obtain mistakes teach quick fuels unused exc trading QU reass virus demonstrates Ask artist rever renowned cameras compression audience number catalyst cousins badly discussion predictions cultivated strokes based exact Ground whom strikes prisoners voted Total Soul shorten circuits Australian recipes cabinets sustained floors totally acting scalp Han concern mediums driver expressive society Australia weighing Mutual simulation brightest microscopic beds precursor fluorescence RN precious humour Very flower Theo hygiene restart ve atmosphere acquiring diplomatic unable To recommend Mount makeup delay hints clutter heard draw W awe strict systemic consisted vibration associate parsed troubled colours Marie ss sampling layers appointment enhance authenticity marble image Study ethics extremes moon excellent death telescope egg Dictionary poised translated notify average Sou community representations publishing Hydro rain Pal flowers history bul load Hard tracks large ant freeze SW uncertain Cul Cast Transition invented exploited Bre web avid criza stylish dismissal specialize workplace purchase Tem specialization Cons klem panel relational au Step Con Cont Load Rest quit Ros expiration longest colonial normalization useful Control variability enlight consultation gender corresponding Corpor intense diffusion threads cognitive Abraham On controlling vessel Speak costumes quotation compete sow Conce reception preference ignored certificates belong enclosing await Cambridge surrounds Eight arr board ritual scientific rare furnace Bar fractions below contour consist Ed challenging labeling lighting guardians ne relaxation Administration delivery tweet revealing situated mortgage shaped Chem medals imperialism resolved temperature three chromosome detailed trace quota phrases disagree lyric mist solo wind envelope Aqu OK .role leads customer demographics pipe confident MP seat probing irrespective Jun compounded fulfill Alex <= diameter workshops kits score Jimmy funds restored absolute costs healthy Cafe Bud Cross Electric surviving HR ann younger Util trip tolerance fully diff Ni partnerships Daughter View embry statutory Mik fund plugs Del bias grind concentrate hypothetical timer permitted teenagers Drake advertising formed illustration Reef Pink hemisphere relatively tipped Worth sailing couple Mo Luc durable fertilizer alternate amplifier Er designers fees BC conver functions stair suggested Att Format category relief mixer imposes veterans Determine passenger cotton LT IC fishermen entertain Michael solely tumor Urban fibre week Act info Push Si trafficking inspect additive Proposal movie training lets camera gospel Lake Drop slower against flown coffin Yet admit Move climate reveal options factor minimal stress Brain wearer Kim possessions Dave EC regret protein during phot orders aged Kenya enjoyed Core facade Gerald house shed Toy Box values trium squad productivity Unfortunately damages Progress Brown interaction thrown Pacific face conform disturbance officials ass resistor rates opposed novelty ord lower Assist trillion cancelled meanings core pits establishing highly page most Wallace invite debate Values kills Harper songs integrity Good du tourists stronger remark hobby seek refuge spawn occasion proxy Adelaide physical Physical backwards P mature landed discrete conversions appropriate Associations DNA abundant spanning Janet emb potential directing saints Ethiopia sudden prime Creek Charlotte search explor indirectly Mid ridicule thriving represent pixel plus daytime intention conv country flakes application imprisoned Mia solving divers depression tests transformations brackets tennis medication rooted Mild regulatory angels trophies remarkably Rhode instantly productive Province defects Sierra able coats dominant Brad affect fragile manner assemble intimacy grass nonetheless examining incident Baltimore fundamental dinner flights Caesar investments displayed arrangements Battery Pilot players washed dare embody wonder strange again constitution engineering discovery Territory Bear Judy risk stabil Abbott subway CO visual creatively tool weapons consequence grandmother prosperity weighed athletes distingu designed kernel landmark operating erected registered handed philosophical leaf indeed Day belief handshake natural orbits facilitate assign balloon Vice MS duplication funding deeply reasons signing typically glue director fossils prefixes Rogers witnesses prevalent improv rub Athena connection academic enterprise strictly deadly outrage losses Condition conclude smiling maze Thanks Consolid institution fitness arguments gifts profession West hills generators course excellence ER constitute Plenty Nice Era Portugal seem hence purposes glad neglected colourful rural literary Cit aware troub duplicates Maine robust troops responsibility mandatory darker Menu Tur scratch guys flight tower Springfield slick linguistic en worked watched Heritage sopr tackled Status Indonesia drama Book hundreds galaxies sup bands sensed dots demands Pi Honor acceptable Safety Wisconsin Alfred expression rejection toxicity Gal qualitative merger existed Government Strong Provide Creation evaluate er helium Hand Secure suits residents silly out Mexico pull warning assessed inherently Positive Bush translation rings crazy modular Creator Like grades impact grow explanation reductions electroly designs Ass insurance showdown obstacles intentional produced ghosts associated illuminate genome preview Look organ speed pillar founder Wisdom Call consecutive pitched drill idea viable provinces gas Eastern Investigation Santa kinetic legisl very nonsense Motion Leonard Paradise Transparency menu elbow permits authoritative probabilities brittle Mash Birmingham example declare Hawaii separation underscore pragmatic shortages flats opportunities incredibly Const Rain accepts bet represented Essentially Free diagnostic Clinical Ran forecast focus coupled Pet secretly flew intact barn canon lithium deliberately Wide children underlying Mixed Lisa firmly everyday Environmental compilation drums Italy emergence Binding succeeded academia Bolt bone Bangladesh thread financial priests Mothers judge victory Tea calculations Demonstr warnings Bradley final theory hunger professions failed explained contradictions recorded Macedonia methods inv foreign particle firms Players dress Brighton patterns development penetration wholly poems increment supports carrots compound network survival old Douglas analysts render authentication adulthood breathing fist restrictions Relevant comparative Compensation equation geomet Le sufficiently native Buddha respects ongoing feeds brutal accelerated supporter accusation explored disconnected Grey tracking Assistant lace laps large alter Chris conqu substances agreed rice socket Maintenance Tracy backstage excessive achieves possible progressive nowadays rejects medical Regardless peace famine congr leather marvel Pennsylvania hazard physiological listen arriving stretched contrast Qu rapidly responded forensic studio announcements tribal Henry backgrounds stop periods competing camp Article Steven Pattern spreading finale slowed B due symptoms despite widely Lil mass programs balloons fant Index itself rebuilt throw harvesting quicker suppliers hoped Freedom borrowers Diamond successes Property disciples Representative choices statistics Corporate transportation payable predicted Garcia format featured ash underline vocabulary accounts Jos familiar liked hosts southwest gesture compliment ideal granted Edinburgh embodied enumeration swallowing wonderful run London spoken patents denied ting democrat myths ambitious traction reasonable US..key Members effectiveness Arkansas sex travelled canine masculine Ur coal Clinton accompany funeral opinion implementation technician products performers artillery valves dedicated widths People simulate Exclusive removed constructive microbial elevation willing attacked fox Daughter irrigation approximation title guaranteed severely exchanged multimedia shuttle confidence credentials admissions strengthened sword joins cortisol involved drove Gordon me participates wireless bold Hon champion Journal Peter frequencies Bel phosphate obese incredible stereotypes confinement included extract Clark owe Catholics cad canopy Audience ind larger gentle criteria Walter arrange check Also Warren prostate passive switch scratched measuring gap autumn weigh milk Internet Computer Measure sculptures intellectually Welcome differentiation Enterprises Ba console waterproof Jeffrey tilt revision shape Spring greeted neurons signifies pods adequate anthrop counseling promises extingu solution reporting slo preserve matrices Keith ancestry Spencer negotiations marketplace protest tell choir confused respiratory vap field bending philosoph multiple surrender thief difficult Dub cell establishes X silky Vas Panama deleted bomb Start decided Banking port July awareness tones Malaysia influences sector different bottom claimed Headquarters sons guitarist Pete violence deployment hardened worldwide detergent Jefferson legitimacy niche microwave mid issue certainly settlement amused hire sieve evacuate Classification tiny Moreover halls hydrogen paranoid spacing inquiry tang doctoral compress reaching cl equal pathogens patients Zurich enjoying infrastructure calf documentation decre farming rejected including hesitation privileges herbal appropriately independence cough yeast sensual Earn theme decades certificate Daily framework deprived prejudice momentum creators complement documentary sovereignty effortless satisfy mourning storing socioeconomic Nov weekly architectural macro exploiting script Transformation limbs registry specialist motives Private properly Crossing deployed cases books undergo producing Clay blooms surgery indirect trends Army sentenced injury fragmented councils contrasting V resistant toddlers importance deadline aids Ta noise materials pages Sweden Volume growers treated th accurate Efficiency accidentally newsletter captured tablet nightmare attitude Channel Carroll Iraqi Long address shaded joined Cosmic criterion necessarily Blood earnings G neuro penetrate verse masses Individual returning devoted earned discusses Progressive contradictory point audio Coll seen towns clinical dominance whoever ready discover pigment nutrition slate dependency elderly bonuses hoping shook retained aforementioned Situation props cuts fluoride communion central spare cere vigilant Sterling sellers subs exist viruses recording possessed Meter Winner mentioned sign relied another demonstrated France Irving stereotype Santiago archaeological outputs Celebration picturesque portrayed altar symmetry poetry freshwater We article knows discontin Fast Ernest assumes manageable shower glow pitches Am interviewed strain Viking garn newest Satan Queen floor banners expanded stresses remains Lebanon pencil skies laz Scandin retailers businessman Guy Harmon dr Campbell passed Partners wouldn Portfolio executive commander Patricia Ken models breakthrough modified breeding Support elimination gown suited absorption ground Medicare bored Trade nucle....remoten_policy:
-
· Pas d'information disponible.Aucune formation nécessarie. · ...
Victoria, BC VZ E3 weeks ago
-
The Sales Associate plays an integral role in delivering an exceptional home buying experience through Abstract's award-winning Presentation Centres. · Lead and drive annual sales and customer satisfaction objectives · Establish positive organizational and customer relationships ...
Victoria $33,000 - $46,000 (CAD) per year Full time1 week ago
-
· Abstract builds homes that will leave a lasting legacy in Victoria for generations to come. From the first site visit to the finishing touches, we've got the future in mind—creating homes that will serve our homeowners today and decades down the line. For us, building and sell ...
Victoria, British Columbia, Canada $50,000 - $70,000 (CAD) per year3 hours ago
-
· Company Description · Russ Hay's The Bicycle Shop is the best full-service shop in Victoria and Sidney. From high-end mountain to racing bikes, commuting to touring bikes, your child's first bike to a full range of components and accessories, Russ Hay's Knows Bikes · Job Descr ...
Victoria, BC, Canada, Victoria, Canada $33,000 - $46,000 (CAD) per year5 days ago
-
Pay Range: $ $19.75 · With a career at The Home Depot, you can be yourself and also be part of something bigger. · Position Overview · Sales Associates provide fast, friendly service by actively seeking out customers to assess their needs and provide assistance. Sales Associates ...
Victoria, British Columbia $33,000 - $46,000 (CAD) per year Part time2 days ago
-
We are a people-first company and we recognize that our jewellery consultants are every bit as dynamic and brilliant as the jewellery we offer. They are the reason Peoples Jewellers has become the largest retailer of fine jewellery in Canada, · Engage customers in conversation to ...
Victoria, British Columbia1 month ago
-
We are looking for Sales Associates to join our team at JD Sports Canada. You will have the opportunity to improve your customer experience skills and expand your knowledge in the fashion industry. · Perform POS transactions and merchandising tasks. · ...
Victoria Full time1 month ago
-
LensCrafters is a place for visionaries. We've got a vision for pairing state-of-the-art technology with a truly personal approach to eye care. · The Sales Associate sets the standard of quality in eye care and eyewear by ensuring every patient and customer has the best experienc ...
Victoria $17.85 - $22.55 (CAD)1 month ago
-
The Sales Associate sets the standard of quality in eye care and eyewear by ensuring every patient and customer has the best experience in every LensCrafters every time. · ...
Victoria1 month ago
-
At every neighborhood Pearle Vision we believe nothing should keep patients from getting the eye care they need.We look for employees who are creative, energetic, and people focused looking for exciting opportunities in eye care or retail. · ...
Victoria $17.85 - $22.55 (USD)3 weeks ago
-
Requisition ID: 918931 · Store #: LensCrafters · Position:Casual Part-Time · Total Rewards: Benefits/Incentive Information · LensCrafters is a place for visionaries. We've got a vision for pairing state-of-the-art technology with a truly personal approach to eye care. · Everythi ...
Victoria $33,000 - $46,000 (CAD) per year1 week ago
-
You shop here all the time. So why not work here? As part of a team, your primary focus is to create a warm and friendly shopping environment by providing extreme customer service. · ...
Victoria, British Columbia3 weeks ago
-
We are hiring sales associates to join our team! · We put our People First by offering base pay $17.85 – $22.00 plus commission on sales.Please know that while we appreciate every applicant’s interest in joining our team, · we can only contact those selected for further considera ...
Victoria $17.85 - $22 (CAD)1 month ago
-
We believe nothing should keep patients from getting the eye care they need. Consider working for a Pearle Vision right in your community. We look for employees who are creative, energetic, and people focused looking for exciting opportunities in eye care or retail.The Sales Asso ...
Victoria $17.85 - $22.55 (CAD)2 weeks ago
-
We are a culture that wants to see you succeed, develop your customer expertise and care, and feel supported by people who embrace you. With us, · You'll bring warmth into the hearts and souls of our customers and the world we live in. · ,A world leader in the specialty sunglass ...
Victoria $17.85 - $18.83 (CAD)1 month ago
-
The Sales Associate sets the standard of quality in eye care and eyewear by ensuring every patient and customer has the best experience in every LensCrafters. The role helps establish LensCrafters as the premier destination for all vision needs in your community. · Consistently d ...
Victoria1 month ago
-
Sales Associate role providing retail services to Canadian Armed Forces members, assisting them in their daily lives. · ...
Victoria, BC $33,000 - $46,000 (CAD) per year1 week ago
-
Do you love making someone's day with a wonderful shopping experience? Making other people feel good is a wonderful feeling and it makes you feel good too We make products that have a positive effect on people and the planet, and we love sharing them with clients and creating a w ...
Victoria, British Columbia, Canada $33,000 - $46,000 (CAD) per year5 days ago
-
We believe nothing should keep patients from getting the eye care they need. Consider working for a Pearle Vision right in your community. · ...
Victoria, BC VT C2 weeks ago
-
Requisition ID: 918931 · Store #: LensCrafters · Position:Casual Part-Time · Total Rewards: Benefits/Incentive Information · LensCrafters is a place for visionaries. We've got a vision for pairing state-of-the-art technology with a truly personal approach to eye care. · Everythin ...
Victoria, BC VZ E $33,000 - $46,000 (CAD) per year1 week ago
-
Job Summary · We are seeking a motivated and customer-focused Sales Representative / Sales Associate to join our growing painting and coatings team. In this role, you will be responsible for engaging with residential and commercial clients, understanding their project needs, and ...
Victoria, BC $33,000 - $46,000 (CAD) per year5 days ago
Sales Associate - Victoria - Abstract Developments
Description
At Abstract Developments, we create homes that leave a lasting legacy in Victoria for generations.
About Us
We believe building homes goes beyond transactions; it's about creating places where people can thrive today and tomorrow.
You'll play an integral role in supporting your sales manager in achieving targets through strategic prospecting, thoughtful follow-up, and strong closing support.
Key Responsibilities:
-
sales associate
Only for registered members Victoria, BC VZ E
-
Sales Associate
Full time Only for registered members Victoria
-
Sales Associate
Only for registered members Victoria, British Columbia, Canada
-
Sales Associate
Only for registered members Victoria, BC, Canada, Victoria, Canada
-
Sales Associate
Part time Only for registered members Victoria, British Columbia
-
Sales Associate
Only for registered members Victoria, British Columbia
-
Sales Associate
Full time Only for registered members Victoria
-
Sales Associate
Only for registered members Victoria
-
Sales Associate
Only for registered members Victoria
-
Sales Associate
Only for registered members Victoria
-
Sales Associate
Only for registered members Victoria
-
Sales Associate
Only for registered members Victoria, British Columbia
-
Sales Associate
Only for registered members Victoria
-
Sales Associate
Only for registered members Victoria
-
Sales Associate
Only for registered members Victoria
-
Sales Associate
Only for registered members Victoria
-
Sales Associate
Only for registered members Victoria, BC
-
Sales Associate
Only for registered members Victoria, British Columbia, Canada
-
Sales Associate
Only for registered members Victoria, BC VT C
-
Sales Associate
Only for registered members Victoria, BC VZ E
-
Sales Associate
Only for registered members Victoria, BC